PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold00361-augustus-gene-0.20-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB_related
Protein Properties Length: 305aa    MW: 33125 Da    PI: 10.1078
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold00361-augustus-gene-0.20-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.3e-1498142347
                                                    SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                                Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                                    +WT+eE+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  maker-scaffold00361-augustus-gene-0.20-mRNA-1  98 PWTEEEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 142
                                                    8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.763520IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.21191147IPR017930Myb domain
SuperFamilySSF466895.38E-1793147IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-1794145IPR006447Myb domain, plants
SMARTSM007171.6E-1095145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-1197142IPR009057Homeodomain-like
PfamPF002495.1E-1198142IPR001005SANT/Myb domain
CDDcd001671.68E-998143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MSRTCSQCGN NGHNSRTCTE ASSGGCGGGG GGDASGENGI MLFGVRVTEV NSFRKSASMT  60
NLSQFDQQPQ DPNVESGYAS DDVVHPSGRS RERKRGVPWT EEEHRLFLLG LQKVGKGDWR  120
GISRNFVKTR TPTQVASHAQ KYFLRRTNLN RRRRRSSLFD ITTTDTLVGS LMEEEQVHQE  180
TAPLPKRQPH LSRNLGGFPV STFPATLSAV SHVGENQVEN LSFMRTTTST KPIRPIPILP  240
VPPSSKMAEL NLNQKETLPL SLKLSPASSD EQSPPPPPPP GKHSSAFQAM SGNFSSNGDS  300
IISVA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006483742.11e-125PREDICTED: transcription factor MYB1R1 isoform X2
SwissprotQ2V9B05e-50MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A067GVG81e-126A0A067GVG8_CITSI; Uncharacterized protein
STRINGVIT_01s0026g01050.t011e-119(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.23e-73MYB_related family protein